HEXA (Myc-DDK-tagged)-Human hexosaminidase A (alpha polypeptide) (HEXA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXA (Myc-DDK-tagged)-Human hexosaminidase A (alpha polypeptide) (HEXA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HEXA (untagged)-Human hexosaminidase A (alpha polypeptide) (HEXA)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Recombinant protein of human hexosaminidase A (alpha polypeptide) (HEXA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, HEXA (Myc-DDK tagged) - Human hexosaminidase A (alpha polypeptide) (HEXA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, HEXA (mGFP-tagged) - Human hexosaminidase A (alpha polypeptide) (HEXA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
HEXA (GFP-tagged) - Human hexosaminidase A (alpha polypeptide) (HEXA)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human hexosaminidase A (alpha polypeptide) (HEXA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HEXA (Myc-DDK tagged) - Human hexosaminidase A (alpha polypeptide) (HEXA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HEXA (mGFP-tagged) - Human hexosaminidase A (alpha polypeptide) (HEXA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human hexosaminidase A (alpha polypeptide) (HEXA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human hexosaminidase A (alpha polypeptide) (HEXA), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HEXA (untagged)-Human hexosaminidase A (alpha polypeptide) (HEXA)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit anti-HEXA Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HEXA |
Beta-hexosaminidase alpha / HEXA (23-529, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Lenti ORF clone of Human hexosaminidase A (alpha polypeptide) (HEXA), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Transient overexpression lysate of hexosaminidase A (alpha polypeptide) (HEXA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-HEXA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV |
HEXA rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human HEXA |
Beta-hexosaminidase alpha / HEXA (89-529, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Beta-hexosaminidase alpha / HEXA (89-529, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Beta-hexosaminidase alpha / HEXA (23-529, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
HEXA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
HEXA MS Standard C13 and N15-labeled recombinant protein (NP_000511)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of HEXA (NM_000520) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HEXA (NM_000520) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HEXA (NM_000520) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack