Products

cDNA Clones (11)
Proteins (6)
Antibodies (3)
Jump to Filters
View as table Download
CACNG4 (NM_014405) Human Tagged ORF Clone
RC205154

USD 420.00

In Stock

CACNG4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNG4 (NM_014405) Human Tagged ORF Clone Lentiviral Particle
RC205154L1V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG4 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CACNG4 (NM_014405) Human Tagged ORF Clone Lentiviral Particle
RC205154L2V

USD 820.00

3 Weeks

Lenti ORF particles, CACNG4 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CACNG4 (NM_014405) Human Tagged ORF Clone
RG205154

USD 460.00

In Stock

CACNG4 (GFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNG4 (NM_014405) Human Tagged ORF Clone
RC205154L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG4 (NM_014405) Human Tagged ORF Clone Lentiviral Particle
RC205154L3V

USD 820.00

7 Weeks

Lenti ORF particles, CACNG4 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG4 (NM_014405) Human Tagged ORF Clone
RC205154L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG4 (NM_014405) Human Tagged ORF Clone Lentiviral Particle
RC205154L4V

USD 820.00

5 Weeks

Lenti ORF particles, CACNG4 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG4 (NM_014405) Human Tagged Lenti ORF Clone
RC205154L2

USD 768.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CACNG4 (NM_014405) Human Untagged Clone
SC122095

USD 310.00

In Stock

CACNG4 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CACNG4 (NM_014405) Human Tagged ORF Clone
RC205154L1

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CACNG4 (Center) Rabbit Polyclonal Antibody
AP50706PU-N

USD 450.00

2 Weeks

CACNG4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human CACNG4
CACNG4 Rabbit Polyclonal Antibody
TA331463

USD 310.00

5 Days

Rabbit polyclonal Anti-CACNG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL
CACNG4 Rabbit Polyclonal Antibody
TA338573

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL
CACNG4 (NM_014405) Human Over-expression Lysate
LC415298

USD 121.00

2 Weeks

CACNG4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNG4 (NM_014405) Human Over-expression Lysate
LY415298

USD 396.00

5 Days

Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 4 (CACNG4)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNG4 (NM_014405) ICC Control Block
TB405154

USD 1,070.00

4 Weeks

Transient overexpression of CACNG4 (NM_014405) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNG4 (NM_014405) Human Recombinant Protein
TP762647

USD 261.00

2 Weeks

Purified recombinant protein of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), full length, with N-GST and C-His tag, expressed in E.coli, 50ug

Tag N-GST and C-HIS
Expression Host E. coli
CACNG4 Cytosection
TS405154

USD 225.00

4 Weeks

Transient overexpression of CACNG4 (NM_014405) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CACNG4 Cytosection
TS405154P5

USD 889.00

4 Weeks

Transient overexpression of CACNG4 (NM_014405) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack