Products

Antibodies (28)
cDNA Clones (12)
Proteins (9)
Jump to Filters
View as table Download
Calcium binding protein P22 (CHP1) (NM_007236) Human Tagged ORF Clone Lentiviral Particle
RC201928L3V

USD 820.00

6 Weeks

Lenti ORF particles, CHP1 (Myc-DDK tagged) - Human calcium binding protein P22 (CHP), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody
TA308146

USD 415.00

In Stock

Rabbit Polyclonal antibody to Calcium binding protein P22

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 47 and 141 of Calcium binding protein P22 (Uniprot ID#Q99653)
Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody
TA340165

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM
Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody
TA312339

USD 345.00

In Stock

Rabbit polyclonal anti-CHP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CHP.
Calcium-binding protein p22 (1-195, His-tag) Human Protein
AR09534PU-L

USD 745.00

2 Weeks

Calcium-binding protein p22 (1-195, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Calcium-binding protein p22 (1-195, His-tag) Human Protein
AR09534PU-N

USD 300.00

2 Weeks

Calcium-binding protein p22 (1-195, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI4B9]
CF810226

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CHP mouse monoclonal antibody,clone OTI4B9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B9]
TA810226AM

USD 420.00

4 Weeks

CHP mouse monoclonal antibody,clone OTI4B9, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B9]
TA810226BM

USD 420.00

4 Weeks

CHP mouse monoclonal antibody,clone OTI4B9, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Calcium binding protein P22 (CHP1) (NM_007236) ICC Control Block
TB401928

USD 1,040.00

4 Weeks

Transient overexpression of CHP1 (NM_007236) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Calcium binding protein P22 (CHP1) Cytosection
TS401928

USD 225.00

4 Weeks

Transient overexpression of CHP1 (NM_007236) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Calcium binding protein P22 (CHP1) Cytosection
TS401928P5

USD 889.00

4 Weeks

Transient overexpression of CHP1 (NM_007236) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack