Products

View as table Download

FZD9 (Myc-DDK-tagged)-Human frizzled family receptor 9 (FZD9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

FZD9 (GFP-tagged) - Human frizzled family receptor 9 (FZD9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD9 (untagged)-Human frizzled family receptor 9 (FZD9)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-FZD9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.

Lenti ORF clone of Human frizzled family receptor 9 (FZD9), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

FZD9 (untagged)-Human frizzled homolog 9 (Drosophila) (cDNA clone MGC:26396 IMAGE:4791657), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-FZD9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS

FZD9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of frizzled homolog 9 (Drosophila) (FZD9)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human frizzled family receptor 9 (FZD9), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal anti-FZD9 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9.

Rabbit Polyclonal Anti-FZD9 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from 1st extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bovine, Bat, Rabbit, Opossum (100%); Platypus (86%).

Rabbit Polyclonal Anti-FZD9 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Mouse, Rat, Bovine (93%).

Transient overexpression of FZD9 (NM_003508) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of FZD9 (NM_003508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of FZD9 (NM_003508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack