WNT5B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT5B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT5B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT5B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT5B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, WNT5B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT5B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
WNT5B (GFP-tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WNT5B (GFP-tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT5B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT5B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT5B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT5B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
WNT5B (untagged)-Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
WNT5B (untagged)-Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Monoclonal antibody against WNT5B
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal WNT5B Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit Polyclonal Anti-WNT5B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the middle region of human WNT5B. Synthetic peptide located within the following region: YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
WNT5B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-WNT5B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the C terminal of human WNT5B. Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal WNT5B Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
WNT5B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-WNT5B Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | WNT5B antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT5B. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset (100%); Gorilla, Elephant, Panda, Dog, Horse, Rabbit, Pig, Opossum (93%); Mouse, Hamster, Bovine (86%). |
Rabbit Polyclonal Anti-WNT5B Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | WNT5B antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT5B. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey (100%); Gorilla, Marmoset (93%); Dog, Elephant, Horse, Rabbit, Opossum (86%). |
Rabbit Polyclonal Anti-WNT5B Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | WNT5B antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT5B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Marmoset, Bovine, Dog, Elephant, Panda, Horse, Rabbit, Pig, Platypus (100%); Gibbon, Monkey, Mouse, Rat, Opossum (93%); Hamster (87%); Xenopus (80%). |
Transient overexpression of WNT5B (NM_030775) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WNT5B (NM_032642) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human wingless-type MMTV integration site family, member 5B (WNT5B), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug
Tag | N-GST and C-HIS |
Expression Host | E. coli |
Transient overexpression of WNT5B (NM_030775) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT5B (NM_030775) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of WNT5B (NM_032642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT5B (NM_032642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack