Products

cDNA Clones (7)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
FGF11 (NM_004112) Human Tagged ORF Clone
RC207584

USD 98.00

USD 390.00

In Stock

FGF11 (Myc-DDK-tagged)-Human fibroblast growth factor 11 (FGF11)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FGF11 (NM_004112) Human Tagged ORF Clone
RG207584

USD 460.00

In Stock

FGF11 (GFP-tagged) - Human fibroblast growth factor 11 (FGF11)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FGF11 (NM_004112) Human Tagged ORF Clone
RC207584L3

USD 620.00

3 Weeks

Lenti ORF clone of Human fibroblast growth factor 11 (FGF11), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FGF11 (NM_004112) Human Tagged ORF Clone
RC207584L4

USD 620.00

3 Weeks

Lenti ORF clone of Human fibroblast growth factor 11 (FGF11), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FGF11 (NM_004112) Human Tagged ORF Clone Lentiviral Particle
RC207584L4V

USD 820.00

6 Weeks

Lenti ORF particles, FGF11 (mGFP-tagged) - Human fibroblast growth factor 11 (FGF11), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FGF11 (NM_004112) Human Untagged Clone
SC128241

USD 310.00

In Stock

FGF11 (untagged)-Human fibroblast growth factor 11 (FGF11)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
FGF11 Rabbit Polyclonal Antibody
TA335067

USD 375.00

5 Days

Rabbit Polyclonal Anti-FGF11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF11 antibody is: synthetic peptide directed towards the N-terminal region of Human FGF11. Synthetic peptide located within the following region: LASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLC
FGF11 Rabbit Polyclonal Antibody
TA335068

USD 375.00

5 Days

Rabbit Polyclonal Anti-FGF11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF11 antibody: synthetic peptide directed towards the N terminal of human FGF11. Synthetic peptide located within the following region: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL
FGF11 (NM_004112) Human Over-expression Lysate
LC418205

USD 121.00

2 Weeks

FGF11 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FGF11 (NM_004112) Human Over-expression Lysate
LY418205

USD 396.00

5 Days

Transient overexpression lysate of fibroblast growth factor 11 (FGF11)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FGF11 ICC Control Block
TB407584

USD 1,040.00

4 Weeks

Transient overexpression of FGF11 (NM_004112) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FGF11 Cytosection
TS407584

USD 225.00

4 Weeks

Transient overexpression of FGF11 (NM_004112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FGF11 Cytosection
TS407584P5

USD 889.00

4 Weeks

Transient overexpression of FGF11 (NM_004112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack