Germany
Japan
United Kingdom
China
FGF18 (Myc-DDK-tagged)-Human fibroblast growth factor 18 (FGF18)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, FGF18 (Myc-DDK tagged) - Human fibroblast growth factor 18 (FGF18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FGF18 (mGFP-tagged) - Human fibroblast growth factor 18 (FGF18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
FGF18 (GFP-tagged) - Human fibroblast growth factor 18 (FGF18)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human fibroblast growth factor 18 (FGF18), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FGF18 (Myc-DDK tagged) - Human fibroblast growth factor 18 (FGF18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FGF18 (mGFP-tagged) - Human fibroblast growth factor 18 (FGF18), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human fibroblast growth factor 18 (FGF18), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human fibroblast growth factor 18 (FGF18), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human fibroblast growth factor 18 (FGF18), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of fibroblast growth factor 18 (FGF18)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Purified recombinant protein of Human fibroblast growth factor 18 (FGF18).
| Tag | Tag Free |
| Expression Host | E. coli |
FGF18 (untagged)-Human fibroblast growth factor 18, transcript variant 1 (cDNA clone MGC:10529 IMAGE:3948893), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
FGF18 (untagged)-Human fibroblast growth factor 18 (FGF18)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FGF18 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human FGF18 |
FGF18 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-FGF-18 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant human FGF-18 |
Rabbit Polyclonal Anti-FGF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF18 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF18. Synthetic peptide located within the following region: GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE |
Transient overexpression of FGF18 (NM_003862) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FGF18 (NM_003862) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FGF18 (NM_003862) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- FGF18
Pathways
- Melanoma