Products

View as table Download

CDS2 (Myc-DDK-tagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CDS2 (Myc-DDK tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CDS2 (mGFP-tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CDS2 (GFP-tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

CDS2 (untagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

CDS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CDS2 (untagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-CDS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDS2 antibody is: synthetic peptide directed towards the C-terminal region of Human CDS2. Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA

Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack