Germany
Japan
United Kingdom
China
DNMT3A (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadDNMT3A (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
DNMT3A (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DNMT3A (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DNMT3A (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, DNMT3A (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DNMT3A (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DNMT3A (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3A (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DNMT3A (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3A (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3A (Myc-DDK tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3A (mGFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DNMT3A (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of DNMT3A (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3A (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of DNMT3A (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3A (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DNMT3A (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of DNMT3A (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3A (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of DNMT3A (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DNMT3A (mGFP-tagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DNMT3A (GFP-tagged) - Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DNMT3A (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-DNMT3A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE |
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
DNMT3A (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DNMT3A (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DNMT3A Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DNMT3A |
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DNMT3A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DNMT3A (untagged)-Human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 4
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal DNMT3A Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for anti-DNMT3A antibody: mouse DNMT3 (DNA methyltransferase 3A), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein. |
DNMT3A (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Central region of Human DNMT3A |
DNMT3A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 871-900 amino acids from the C-terminal region of Human DNMT3A. |
Active filters
Target Symbol
- DNMT3A
Pathways
- Metabolic pathways