Products

View as table Download

USD 98.00

USD 390.00

In Stock

NDUFV2 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T

NDUFV2 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NDUFV2 (Myc-DDK tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NDUFV2 (mGFP-tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NDUFV2 (untagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-NDUFV2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ndufv2 antibody: synthetic peptide directed towards the C terminal of human Ndufv2. Synthetic peptide located within the following region: DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK

Rabbit Polyclonal Anti-NDUFV2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ndufv2 antibody is: synthetic peptide directed towards the N-terminal region of Ndufv2. Synthetic peptide located within the following region: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPV

Rabbit polyclonal anti-NDUFV2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFV2.

NDUFV2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

NDUFV2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal antibody to NDUFV2 (NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 249 of NDUFV2 (Uniprot ID#P19404)

Transient overexpression lysate of NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

NDUFV2 (33-249, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

NDUFV2 (33-249, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

NDUFV2 MS Standard C13 and N15-labeled recombinant protein (NP_066552)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-NDUFV2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFV2

USD 1,040.00

4 Weeks

Transient overexpression of NDUFV2 (NM_021074) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of NDUFV2 (NM_021074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of NDUFV2 (NM_021074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack