Products

cDNA Clones (19)
Proteins (10)
Antibodies (2)
Jump to Filters
View as table Download
SUCLG2 (NM_003848) Human Tagged ORF Clone
RC208298

USD 420.00

In Stock

SUCLG2 (Myc-DDK-tagged)-Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SUCLG2 (NM_001177599) Human Tagged ORF Clone
RC230086

USD 420.00

In Stock

SUCLG2 (Myc-DDK-tagged)-Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SUCLG2 (NM_001177599) Human Tagged ORF Clone Lentiviral Particle
RC230086L1V

USD 820.00

6 Weeks

Lenti ORF particles, SUCLG2 (Myc-DDK tagged) - Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SUCLG2 (NM_001177599) Human Tagged ORF Clone Lentiviral Particle
RC230086L2V

USD 820.00

3 Weeks

Lenti ORF particles, SUCLG2 (mGFP-tagged) - Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SUCLG2 (NM_003848) Human Tagged ORF Clone
RG208298

USD 460.00

In Stock

SUCLG2 (GFP-tagged) - Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SUCLG2 (NM_003848) Human Tagged ORF Clone
RC208298L3

USD 620.00

3 Weeks

Lenti ORF clone of Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SUCLG2 (NM_003848) Human Tagged ORF Clone Lentiviral Particle
RC208298L3V

USD 820.00

6 Weeks

Lenti ORF particles, SUCLG2 (Myc-DDK tagged) - Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SUCLG2 (NM_003848) Human Tagged ORF Clone
RC208298L4

USD 620.00

3 Weeks

Lenti ORF clone of Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SUCLG2 (NM_003848) Human Tagged ORF Clone Lentiviral Particle
RC208298L4V

USD 820.00

6 Weeks

Lenti ORF particles, SUCLG2 (mGFP-tagged) - Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SUCLG2 (NM_001177599) Human Tagged ORF Clone
RC230086L3

USD 620.00

3 Weeks

Lenti ORF clone of Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SUCLG2 (NM_001177599) Human Tagged ORF Clone Lentiviral Particle
RC230086L3V

USD 820.00

7 Weeks

Lenti ORF particles, SUCLG2 (Myc-DDK tagged) - Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SUCLG2 (NM_001177599) Human Tagged ORF Clone
RC230086L4

USD 620.00

3 Weeks

Lenti ORF clone of Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SUCLG2 (NM_001177599) Human Tagged ORF Clone Lentiviral Particle
RC230086L4V

USD 820.00

7 Weeks

Lenti ORF particles, SUCLG2 (mGFP-tagged) - Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SUCLG2 (NM_001177599) Human Tagged ORF Clone
RG230086

USD 460.00

3 Weeks

SUCLG2 (GFP-tagged) - Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SUCLG2 (NM_001177599) Human Tagged Lenti ORF Clone
RC230086L2

USD 768.00

In Stock

Lenti ORF clone of Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SUCLG2 (NM_003848) Human Untagged Clone
SC317700

USD 760.00

3 Weeks

SUCLG2 (untagged)-Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SUCLG2 (NM_003848) Human Untagged Clone
SC321824

USD 310.00

In Stock

SUCLG2 (untagged)-Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SUCLG2 (NM_001177599) Human Tagged ORF Clone
RC230086L1

USD 620.00

3 Weeks

Lenti ORF clone of Human succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SUCLG2 Rabbit Polyclonal Antibody
TA308054

USD 415.00

5 Days

Rabbit Polyclonal antibody to SUCLG2 (succinate-CoA ligase, GDP-forming, beta subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 234 of SUCLG2 (Uniprot ID#Q96I99)
SUCLG2 (NM_003848) Human Over-expression Lysate
LC418394

USD 121.00

In Stock

SUCLG2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SUCLG2 (NM_003848) Human Over-expression Lysate
LY418394

USD 396.00

5 Days

Transient overexpression lysate of succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SUCLG2 Rabbit Polyclonal Antibody
TA333987

USD 375.00

5 Days

Rabbit Polyclonal Anti-SUCLG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SUCLG2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SUCLG2. Synthetic peptide located within the following region: AKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFV
SUCLG2 (NM_001177599) Human Over-expression Lysate
LC433086

USD 121.00

2 Weeks

SUCLG2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SUCLG2 (NM_001177599) Human Over-expression Lysate
LY433086

USD 396.00

5 Days

Transient overexpression lysate of succinate-CoA ligase, GDP-forming, beta subunit (SUCLG2), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SUCLG2 (NM_001177599) Human Untagged Clone
SC328724

USD 740.00

3 Weeks

SUCLG2 (untagged)-Human succinate-CoA ligase GDP-forming beta subunit (SUCLG2) nuclear gene encoding mitochondrial protein transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SUCLG2 (NM_003848) ICC Control Block
TB408298

USD 1,070.00

4 Weeks

Transient overexpression of SUCLG2 (NM_003848) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SUCLG2 (NM_001177599) ICC Control Block
TB430086

USD 1,070.00

4 Weeks

Transient overexpression of SUCLG2 (NM_001177599) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SUCLG2 Cytosection
TS408298

USD 225.00

4 Weeks

Transient overexpression of SUCLG2 (NM_003848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SUCLG2 Cytosection
TS408298P5

USD 889.00

4 Weeks

Transient overexpression of SUCLG2 (NM_003848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SUCLG2 Cytosection
TS430086

USD 225.00

4 Weeks

Transient overexpression of SUCLG2 (NM_001177599) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SUCLG2 Cytosection
TS430086P5

USD 889.00

4 Weeks

Transient overexpression of SUCLG2 (NM_001177599) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack