Products

Primary Antibodies (3)
View as table Download

Glutathione S Transferase kappa 1 (GSTK1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 99~128 amino acids from the Central region of Human GSTK1

Rabbit Polyclonal Anti-GSTK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the N terminal of human GSTK1. Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK

Rabbit Polyclonal Anti-GSTK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the middle region of human GSTK1. Synthetic peptide located within the following region: NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL