Germany
Japan
United Kingdom
China
ADH4 (Myc-DDK-tagged)-Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ADH4 (Myc-DDK tagged) - Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ADH4 (mGFP-tagged) - Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ADH4 (GFP-tagged) - Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADH4 (Myc-DDK tagged) - Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADH4 (mGFP-tagged) - Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ADH4 (untagged)-Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ADH4 (untagged)-Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal ADH4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ADH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-348 amino acids from the C-terminal region of human ADH4. |
ADH4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-ADH4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV |
Rabbit Polyclonal Anti-ADH4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET |
Anti-ADH4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human alcohol dehydrogenase 4 (class II), pi polypeptide |
Transient overexpression of ADH4 (NM_000670) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), full length, with N-GST and C-His tag, expressed in E.coli, 50ug
| Tag | N-GST and C-HIS |
| Expression Host | E. coli |
Transient overexpression of ADH4 (NM_000670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADH4 (NM_000670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ADH4
Pathways
- Metabolism of xenobiotics by cytochrome P450