UGT1A4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UGT1A4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT1A4 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT1A4 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
UGT1A4 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
UGT1A4 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit anti-UGT1A4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A4 |
Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-UGT1A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK |
UGT1A4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
UGT1A4 MS Standard C13 and N15-labeled recombinant protein (NP_009051)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of UGT1A4 (NM_007120) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGT1A4 (NM_007120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UGT1A4 (NM_007120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack