Products

View as table Download

UGT1A4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UGT1A4 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UGT1A4 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

UGT1A4 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

UGT1A4 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit anti-UGT1A4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A4

Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-UGT1A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK

UGT1A4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

UGT1A4 MS Standard C13 and N15-labeled recombinant protein (NP_009051)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of UGT1A4 (NM_007120) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of UGT1A4 (NM_007120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of UGT1A4 (NM_007120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack