Products

View as table Download

USD 98.00

USD 390.00

In Stock

IFNA5 (Myc-DDK-tagged)-Human interferon, alpha 5 (IFNA5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human interferon, alpha 5 (IFNA5)

Tag C-Myc/DDK
Expression Host HEK293T

IFNA5 (GFP-tagged) - Human interferon, alpha 5 (IFNA5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human interferon, alpha 5 (IFNA5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 5 (IFNA5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 5 (IFNA5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 5 (IFNA5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-IFNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

IFNA5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

IFNA5 MS Standard C13 and N15-labeled recombinant protein (NP_002160)

Tag C-Myc/DDK
Expression Host HEK293

IFNA5 (untagged)-Human interferon, alpha 5 (IFNA5)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 1,040.00

4 Weeks

Transient overexpression of IFNA5 (NM_002169) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of IFNA5 (NM_002169) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of IFNA5 (NM_002169) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack