Products

cDNA Clones (40)
Proteins (9)
Antibodies (5)
Jump to Filters
View as table Download
P2RY5 (LPAR6) (NM_005767) Human Tagged ORF Clone
RC207345

USD 420.00

In Stock

LPAR6 (Myc-DDK-tagged)-Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone
RG228834

USD 460.00

In Stock

LPAR6 (GFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone
RC228834

USD 420.00

In Stock

LPAR6 (Myc-DDK-tagged)-Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_001162498) Human Tagged ORF Clone
RC228835

USD 420.00

In Stock

LPAR6 (Myc-DDK-tagged)-Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Tagged ORF Clone
RG207345

USD 460.00

3 Weeks

LPAR6 (GFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Tagged ORF Clone
RC207345L3

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_005767) Human Tagged ORF Clone Lentiviral Particle
RC207345L3V

USD 820.00

6 Weeks

Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_005767) Human Tagged ORF Clone
RC207345L4

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_005767) Human Tagged ORF Clone Lentiviral Particle
RC207345L4V

USD 820.00

6 Weeks

Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone
RC228834L3

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone Lentiviral Particle
RC228834L3V

USD 820.00

6 Weeks

Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone
RC228834L4

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone Lentiviral Particle
RC228834L4V

USD 820.00

6 Weeks

Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_001162498) Human Tagged ORF Clone
RC228835L3

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_001162498) Human Tagged ORF Clone Lentiviral Particle
RC228835L3V

USD 820.00

6 Weeks

Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_001162498) Human Tagged ORF Clone
RC228835L4

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_001162498) Human Tagged ORF Clone Lentiviral Particle
RC228835L4V

USD 820.00

6 Weeks

Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2RY5 (LPAR6) (NM_005767) Human Mutant ORF Clone
RC402790

USD 590.00

2 Weeks

LPAR6 Mutant (S3T), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA

Mutation S3T
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Mutant ORF Clone
RC402791

USD 590.00

2 Weeks

LPAR6 Mutant (D63V), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA

Mutation D63V
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Mutant ORF Clone
RC402792

USD 590.00

2 Weeks

LPAR6 Mutant (G146R), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA

Mutation G146R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Mutant ORF Clone
RC402793

USD 420.00

2 Weeks

LPAR6 Mutant (Q155X), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA

Mutation Q155X
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Mutant ORF Clone
RC402794

USD 590.00

2 Weeks

LPAR6 Mutant (I188F), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA

Mutation I188F
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Mutant ORF Clone
RC402795

USD 590.00

2 Weeks

LPAR6 Mutant (E189K), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA

Mutation E189K
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Mutant ORF Clone
RC402796

USD 590.00

2 Weeks

LPAR6 Mutant (C278Y), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA

Mutation C278Y
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_001162498) Human Tagged ORF Clone
RG228835

USD 460.00

3 Weeks

LPAR6 (GFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2RY5 (LPAR6) (NM_005767) Human Untagged Clone
SC116518

USD 310.00

In Stock

LPAR6 (untagged)-Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
P2RY5 (LPAR6) (Center) Rabbit Polyclonal Antibody
AP52517PU-N

USD 450.00

2 Weeks

P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6
P2RY5 (LPAR6) (NM_005767) Human Tagged ORF Clone
RC207345L1

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
P2RY5 (LPAR6) (NM_005767) Human Tagged ORF Clone
RC207345L2

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone
RC228834L1

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
P2RY5 (LPAR6) (NM_001162497) Human Tagged ORF Clone
RC228834L2

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
P2RY5 (LPAR6) (NM_001162498) Human Tagged ORF Clone
RC228835L1

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
P2RY5 (LPAR6) (NM_001162498) Human Tagged ORF Clone
RC228835L2

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
P2RY5 (LPAR6) Rabbit Polyclonal Antibody
TA331336

USD 375.00

5 Days

Rabbit Polyclonal Anti-LPAR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human LPAR6. Synthetic peptide located within the following region: VAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFR
P2RY5 (LPAR6) Rabbit Polyclonal Antibody
TA331337

USD 375.00

5 Days

Rabbit Polyclonal Anti-LPAR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the N-terminal region of Human LPAR6. Synthetic peptide located within the following region: GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK
P2RY5 (LPAR6) Rabbit Polyclonal Antibody
TA341020

USD 425.00

5 Days

Rabbit Polyclonal Anti-LPAR6 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LPAR6 / P2RY5 / P2Y5 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human LPAR6 / P2RY5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Mouse, Rat, Hamster, Rabbit (88%); Bat (81%).
P2RY5 (LPAR6) Rabbit Polyclonal Antibody
TA341367

USD 425.00

5 Days

Rabbit Polyclonal Anti-LPAR6 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LPAR6 / P2RY5 / P2Y5 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human LPAR6 / P2RY5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Hamster, Elephant (100%); Monkey, Rat, Panda, Bovine, Rabbit (94%); Horse (88%).
P2RY5 (LPAR6) (NM_001162497) Human Untagged Clone
SC327469

USD 760.00

3 Weeks

LPAR6 (untagged)-Human lysophosphatidic acid receptor 6 (LPAR6) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2RY5 (LPAR6) (NM_001162498) Human Untagged Clone
SC327470

USD 760.00

3 Weeks

LPAR6 (untagged)-Human lysophosphatidic acid receptor 6 (LPAR6) transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
P2RY5 (LPAR6) (NM_005767) ICC Control Block
TB407345

USD 1,070.00

4 Weeks

Transient overexpression of LPAR6 (NM_005767) in HEK293T cells paraffin embedded controls for ICC/IHC staining

P2RY5 (LPAR6) (NM_001162497) ICC Control Block
TB428834

USD 1,070.00

4 Weeks

Transient overexpression of LPAR6 (NM_001162497) in HEK293T cells paraffin embedded controls for ICC/IHC staining

P2RY5 (LPAR6) (NM_001162498) ICC Control Block
TB428835

USD 1,070.00

4 Weeks

Transient overexpression of LPAR6 (NM_001162498) in HEK293T cells paraffin embedded controls for ICC/IHC staining

P2RY5 (LPAR6) Cytosection
TS407345

USD 225.00

4 Weeks

Transient overexpression of LPAR6 (NM_005767) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

P2RY5 (LPAR6) Cytosection
TS407345P5

USD 889.00

4 Weeks

Transient overexpression of LPAR6 (NM_005767) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack