Products

View as table Download

Rabbit polyclonal anti-OR52A5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52A5.

Rabbit Polyclonal Anti-OR52A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52A5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52A5. Synthetic peptide located within the following region: IRVNKIYGLFVAFAILGFDIIFITLSYVQIFITVFQLPQKEARFKAFNTC

Rabbit Polyclonal Anti-OR52A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52A5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52A5. Synthetic peptide located within the following region: SFFTHRFGSHIPPYIHILLSNLYLLVPPFLNPIVYGVKTKQIRDHIVKVF