Germany
Japan
United Kingdom
China
OR13C5 (Myc-DDK-tagged)-Human olfactory receptor, family 13, subfamily C, member 5 (OR13C5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti-ORF clone of OR13C5 (Myc-DDK-tagged)-Human olfactory receptor, family 13, subfamily C, member 5 (OR13C5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, OR13C5 (Myc-DDK-tagged)-Human olfactory receptor, family 13, subfamily C, member 5 (OR13C5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of OR13C5 (mGFP-tagged)-Human olfactory receptor, family 13, subfamily C, member 5 (OR13C5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, OR13C5 (mGFP-tagged)-Human olfactory receptor, family 13, subfamily C, member 5 (OR13C5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
OR13C5 (GFP-tagged) - Human olfactory receptor, family 13, subfamily C, member 5 (OR13C5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
OR13C5 (untagged)-Human olfactory receptor, family 13, subfamily C, member 5 (OR13C5)
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal anti-OR13C5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the middle region of human OR13C5. Synthetic peptide located within the following region: CGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRNK |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: CYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAFD |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 antibody is: synthetic peptide directed towards the N-terminal region of Human OR13C5. Synthetic peptide located within the following region: ILISILDPHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLS |
Rabbit Polyclonal Anti-OR13C5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR13C5 Antibody: synthetic peptide directed towards the N terminal of human OR13C5. Synthetic peptide located within the following region: ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF |
Transient overexpression of OR13C5 (NM_001004482) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of OR13C5 (NM_001004482) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of OR13C5 (NM_001004482) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- OR13C5
Pathways
- Olfactory transduction