Products

cDNA Clones (7)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
OR13C9 (NM_001001956) Human Tagged ORF Clone
RC223493

USD 420.00

In Stock

OR13C9 (Myc-DDK-tagged)-Human olfactory receptor, family 13, subfamily C, member 9 (OR13C9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
OR13C9 (NM_001001956) Human Tagged ORF Clone
RC223493L3

USD 620.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 13, subfamily C, member 9 (OR13C9), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR13C9 (NM_001001956) Human Tagged ORF Clone Lentiviral Particle
RC223493L3V

USD 820.00

6 Weeks

Lenti ORF particles, OR13C9 (Myc-DDK tagged) - Human olfactory receptor, family 13, subfamily C, member 9 (OR13C9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR13C9 (NM_001001956) Human Tagged ORF Clone
RC223493L4

USD 620.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 13, subfamily C, member 9 (OR13C9), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR13C9 (NM_001001956) Human Tagged ORF Clone Lentiviral Particle
RC223493L4V

USD 820.00

6 Weeks

Lenti ORF particles, OR13C9 (mGFP-tagged) - Human olfactory receptor, family 13, subfamily C, member 9 (OR13C9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR13C9 (NM_001001956) Human Tagged ORF Clone
RG223493

USD 460.00

3 Weeks

OR13C9 (GFP-tagged) - Human olfactory receptor, family 13, subfamily C, member 9 (OR13C9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OR13C9 Rabbit Polyclonal Antibody
TA329445

USD 375.00

5 Days

Rabbit Polyclonal anti-OR13C9 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR
OR13C9 Rabbit Polyclonal Antibody
TA329446

USD 310.00

5 Days

Rabbit Polyclonal anti-OR13C9 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR
OR13C9 (NM_001001956) Human Untagged Clone
SC300360

USD 660.00

3 Weeks

OR13C9 (untagged)-Human olfactory receptor, family 13, subfamily C, member 9 (OR13C9)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OR13C9 (NM_001001956) ICC Control Block
TB423493

USD 1,070.00

4 Weeks

Transient overexpression of OR13C9 (NM_001001956) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OR13C9 Cytosection
TS423493

USD 225.00

4 Weeks

Transient overexpression of OR13C9 (NM_001001956) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

OR13C9 Cytosection
TS423493P5

USD 889.00

4 Weeks

Transient overexpression of OR13C9 (NM_001001956) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack