Products

View as table Download

USD 98.00

USD 390.00

In Stock

ATP5F1 (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, ATP5F1 (Myc-DDK tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ATP5F1 (mGFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP5F1 (Myc-DDK tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP5F1 (mGFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP5F1 (GFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-ATP5F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST

Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

ATP5F1 (untagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Rabbit polyclonal anti-ATP5F1 antibody (Center)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ATP5F1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-195 amino acids from the Central region of human ATP5F1.

ATP5F1 (aa142-153) Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (SIQHIQNAIDTE)

ATP5F1 (83-256, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

ATP5F1 (83-256, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

ATP5F1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

USD 1,040.00

4 Weeks

Transient overexpression of ATP5PB (NM_001688) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ATP5PB (NM_001688) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ATP5PB (NM_001688) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack