Germany
Japan
United Kingdom
China
LHPP (Myc-DDK-tagged)-Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
LHPP (Myc-DDK-tagged)-Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LHPP (Myc-DDK tagged) - Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LHPP (mGFP-tagged) - Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LHPP (Myc-DDK tagged) - Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LHPP (mGFP-tagged) - Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
LHPP (GFP-tagged) - Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LHPP (GFP-tagged) - Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-LHPP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Lhpp antibody is: synthetic peptide directed towards the C-terminal region of Lhpp. Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK |
Rabbit Polyclonal Anti-LHPP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LHPP antibody: synthetic peptide directed towards the middle region of human LHPP. Synthetic peptide located within the following region: ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM |
LHPP (1-270, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
LHPP (1-270, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
LHPP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LHPP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
LHPP MS Standard C13 and N15-labeled recombinant protein (NP_071409)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
LHPP (untagged)-Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
LHPP (untagged)-Human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP) transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of LHPP (NM_022126) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LHPP (NM_001167880) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LHPP (NM_022126) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LHPP (NM_022126) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LHPP (NM_001167880) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LHPP (NM_001167880) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LHPP
Pathways
- Oxidative phosphorylation