Products

Primary Antibodies (2)
View as table Download

Rabbit Polyclonal Anti-AQP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AQP7 antibody: synthetic peptide directed towards the C terminal of human AQP7. Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA

Rabbit Polyclonal Anti-AQP7 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AQP7