Germany
Japan
United Kingdom
China
SLC27A6 (Myc-DDK-tagged)-Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SLC27A6 (Myc-DDK-tagged)-Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SLC27A6 (Myc-DDK tagged) - Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SLC27A6 (mGFP-tagged) - Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SLC27A6 (GFP-tagged) - Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC27A6 (GFP-tagged) - Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SLC27A6 (Myc-DDK tagged) - Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SLC27A6 (mGFP-tagged) - Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SLC27A6 (Myc-DDK tagged) - Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SLC27A6 (mGFP-tagged) - Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SLC27A6 (untagged)-Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SLC27A6 (untagged)-Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SLC27A6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-SLC27A6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC27A6 Antibody: synthetic peptide directed towards the middle region of human SLC27A6. Synthetic peptide located within the following region: KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL |
SLC27A6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SLC27A6 (untagged)-Human solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of SLC27A6 (NM_014031) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SLC27A6 (NM_001017372) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SLC27A6 (NM_014031) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SLC27A6 (NM_014031) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SLC27A6 (NM_001017372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SLC27A6 (NM_001017372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SLC27A6
Pathways
- PPAR signaling pathway