E2F1 (Myc-DDK-tagged)-Human E2F transcription factor 1 (E2F1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
E2F1 (Myc-DDK-tagged)-Human E2F transcription factor 1 (E2F1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human E2F transcription factor 1 (E2F1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
E2F1 (untagged)-Human E2F transcription factor 1 (E2F1)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
E2F1 (GFP-tagged) - Human E2F transcription factor 1 (E2F1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, E2F1 (Myc-DDK tagged) - Human E2F transcription factor 1 (E2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, E2F1 (mGFP-tagged) - Human E2F transcription factor 1 (E2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, E2F1 (Myc-DDK tagged) - Human E2F transcription factor 1 (E2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human E2F transcription factor 1 (E2F1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F1 (mGFP-tagged) - Human E2F transcription factor 1 (E2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human E2F transcription factor 1 (E2F1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human E2F transcription factor 1 (E2F1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human E2F transcription factor 1 (E2F1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal antibody to E2F1 (E2F transcription factor 1)
Applications | IF, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 133 and 362 of E2F1 (Uniprot ID#Q01094) |
Transient overexpression lysate of E2F transcription factor 1 (E2F1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse Monoclonal E2F-1 Antibody
Applications | IF, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal E2F1 Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-E2F-1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F-1 Antibody: Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1 |
E2F1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal E2F-1 phospho S364 antibody
Applications | IHC, WB |
Reactivities | Chimpanzee, Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 360-369 of Human E2F-1. |
Rabbit Polyclonal E2F1 (Thr433) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human E2F1 around the phosphorylation site of Threonine 433 |
Modifications | Phospho-specific |
Rabbit Polyclonal E2F1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human E2F1 |
E2F1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide, corresponding to amino acids 400-450 of Human E2F-1. |
Rabbit Polyclonal Anti-E2F1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the N terminal of human E2F1. Synthetic peptide located within the following region: PARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWA |
Goat Polyclonal Anti-Transcription factor E2F1 (aa314-327) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region of NP_005216.1 (QEVTSEEENRATDS) |
Anti-E2F1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1 |
Rabbit Polyclonal Anti-E2F1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the C terminal of human E2F1. Synthetic peptide located within the following region: REDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF |
E2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005216)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of E2F1 (NM_005225) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of E2F1 (NM_005225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of E2F1 (NM_005225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack