Germany
Japan
United Kingdom
China
CYC1 (Myc-DDK-tagged)-Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CYC1 (Myc-DDK tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYC1 (mGFP-tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYC1 (GFP-tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYC1 (Myc-DDK tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYC1 (mGFP-tagged) - Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-CYC1 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYC1. |
CYC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CYC1 (untagged)-Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CYC1 (untagged)-Human cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYC1 antibody: synthetic peptide directed towards the middle region of human CYC1. Synthetic peptide located within the following region: RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP |
Transient overexpression lysate of cytochrome c-1 (CYC1), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of CYC1 (NM_001916) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYC1 (NM_001916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYC1 (NM_001916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYC1
Pathways
- Parkinson's disease