Products

cDNA Clones (11)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
UQCRC2 (NM_003366) Human Tagged ORF Clone
RC201132

USD 420.00

In Stock

UQCRC2 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
UQCRC2 (NM_003366) Human Tagged ORF Clone Lentiviral Particle
RC201132L1V

USD 820.00

3 Weeks

Lenti ORF particles, UQCRC2 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
UQCRC2 (NM_003366) Human Tagged ORF Clone Lentiviral Particle
RC201132L2V

USD 820.00

6 Weeks

Lenti ORF particles, UQCRC2 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UQCRC2 (NM_003366) Human Tagged ORF Clone
RC201132L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRC2 (NM_003366) Human Tagged ORF Clone Lentiviral Particle
RC201132L3V

USD 820.00

5 Weeks

Lenti ORF particles, UQCRC2 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRC2 (NM_003366) Human Tagged ORF Clone
RC201132L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRC2 (NM_003366) Human Tagged ORF Clone Lentiviral Particle
RC201132L4V

USD 820.00

7 Weeks

Lenti ORF particles, UQCRC2 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRC2 (NM_003366) Human Tagged ORF Clone
RG201132

USD 460.00

3 Weeks

UQCRC2 (GFP-tagged) - Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UQCRC2 (NM_003366) Human Tagged ORF Clone
RC201132L1

USD 768.00

In Stock

Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
UQCRC2 (NM_003366) Human Tagged ORF Clone
RC201132L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UQCRC2 (NM_003366) Human Untagged Clone
SC321400

USD 310.00

In Stock

UQCRC2 (untagged)-Human ubiquinol-cytochrome c reductase core protein II (UQCRC2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
UQCRC2 (NM_003366) Human Over-expression Lysate
LY418722

USD 396.00

5 Days

Transient overexpression lysate of ubiquinol-cytochrome c reductase core protein II (UQCRC2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UQCRC2 Rabbit Polyclonal Antibody
TA338233

USD 375.00

5 Days

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV
UQCRC2 (Complex III subunit Core 2) (15-453, His-tag) Human Protein
AR50550PU-N

USD 1,105.00

2 Weeks

UQCRC2 (Complex III subunit Core 2) (15-453, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
UQCRC2 (Complex III subunit Core 2) (15-453, His-tag) Human Protein
AR50550PU-S

USD 415.00

2 Weeks

UQCRC2 (Complex III subunit Core 2) (15-453, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
UQCRC2 (NM_003366) Human Over-expression Lysate
LC418722

USD 121.00

2 Weeks

UQCRC2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UQCRC2 Rabbit Polyclonal Antibody
TA350584

USD 345.00

In Stock

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC2
UQCRC2 ICC Control Block
TB401132

USD 1,070.00

4 Weeks

Transient overexpression of UQCRC2 (NM_003366) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UQCRC2 Cytosection
TS401132

USD 225.00

4 Weeks

Transient overexpression of UQCRC2 (NM_003366) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UQCRC2 Cytosection
TS401132P5

USD 889.00

4 Weeks

Transient overexpression of UQCRC2 (NM_003366) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack