WNT10B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 10B (WNT10B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT10B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 10B (WNT10B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT10B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT10B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
WNT10B (GFP-tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT10B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 10B (WNT10B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT10B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
WNT10B (untagged)-Human wingless-type MMTV integration site family, member 10B (WNT10B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 10B (WNT10B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 10B (WNT10B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 10B (WNT10B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Wnt10b Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b. |
Rabbit Polyclonal Anti-WNT10B Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR |
Rabbit polyclonal WNT10B Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B. |
Rabbit Polyclonal Anti-WNT10B Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | WNT10B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Elephant, Dog, Bat, Horse, Rabbit, Pig (100%); Hamster (94%); Panda (88%). |
Rabbit Polyclonal Anti-WNT10B Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | WNT10B antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT10B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster, Dog, Bat, Pig (100%); Marmoset, Elephant, Panda, Horse, Rabbit (93%). |
Rabbit Polyclonal Anti-WNT10B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT10B |
Transient overexpression of WNT10B (NM_003394) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WNT10B (NM_003394) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT10B (NM_003394) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack