TKTL2 (Myc-DDK-tagged)-Human transketolase-like 2 (TKTL2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TKTL2 (Myc-DDK-tagged)-Human transketolase-like 2 (TKTL2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human transketolase-like 2 (TKTL2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human transketolase-like 2 (TKTL2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TKTL2 (Myc-DDK tagged) - Human transketolase-like 2 (TKTL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transketolase-like 2 (TKTL2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TKTL2 (mGFP-tagged) - Human transketolase-like 2 (TKTL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TKTL2 (GFP-tagged) - Human transketolase-like 2 (TKTL2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-TKTL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2. Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG |
Rabbit Polyclonal Anti-TKTL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the N terminal of human TKTL2. Synthetic peptide located within the following region: QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAW |
TKTL2 (untagged)-Human transketolase-like 2 (TKTL2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
TKTL2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of transketolase-like 2 (TKTL2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TKTL2 MS Standard C13 and N15-labeled recombinant protein (NP_115512)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of TKTL2 (NM_032136) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TKTL2 (NM_032136) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TKTL2 (NM_032136) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack