Products

View as table Download

TKTL2 (Myc-DDK-tagged)-Human transketolase-like 2 (TKTL2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human transketolase-like 2 (TKTL2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human transketolase-like 2 (TKTL2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

TKTL2 (GFP-tagged) - Human transketolase-like 2 (TKTL2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-TKTL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2. Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG

Rabbit Polyclonal Anti-TKTL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the N terminal of human TKTL2. Synthetic peptide located within the following region: QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAW

TKTL2 (untagged)-Human transketolase-like 2 (TKTL2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

TKTL2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of transketolase-like 2 (TKTL2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

TKTL2 MS Standard C13 and N15-labeled recombinant protein (NP_115512)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of TKTL2 (NM_032136) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of TKTL2 (NM_032136) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TKTL2 (NM_032136) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack