LDHAL6B (Myc-DDK-tagged)-Human lactate dehydrogenase A-like 6B (LDHAL6B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LDHAL6B (Myc-DDK-tagged)-Human lactate dehydrogenase A-like 6B (LDHAL6B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human lactate dehydrogenase A-like 6B (LDHAL6B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
LDHAL6B (GFP-tagged) - Human lactate dehydrogenase A-like 6B (LDHAL6B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human lactate dehydrogenase A-like 6B (LDHAL6B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LDHAL6B (Myc-DDK tagged) - Human lactate dehydrogenase A-like 6B (LDHAL6B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lactate dehydrogenase A-like 6B (LDHAL6B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LDHAL6B (mGFP-tagged) - Human lactate dehydrogenase A-like 6B (LDHAL6B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of lactate dehydrogenase A-like 6B (LDHAL6B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LDHAL6B (untagged)-Human lactate dehydrogenase A-like 6B (LDHAL6B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-LDHAL6B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LDHAL6B Antibody: synthetic peptide directed towards the middle region of human LDHAL6B. Synthetic peptide located within the following region: SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA |
LDHAL6B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LDHAL6B MS Standard C13 and N15-labeled recombinant protein (NP_149972)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of LDHAL6B (NM_033195) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LDHAL6B (NM_033195) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LDHAL6B (NM_033195) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack