Products

View as table Download

PSMC5 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMC5

Rabbit Polyclonal Anti-PSMC5 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PSMC5 Antibody: synthetic peptide directed towards the C terminal of human PSMC5. Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK