Products

View as table Download

Phosphodiesterase 1c / PDE1C Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Horse, Gibbon
Conjugation Unconjugated
Immunogen PDE1C antibody was raised against synthetic 16 amino acid peptide from C-terminus of human PDE1C. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit (100%); Opossum (88%).

Rabbit Polyclonal Anti-ATIC Antibody

Applications WB
Reactivities Hamster, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG