Products

View as table Download

ADCY2 (Myc-DDK-tagged)-Human adenylate cyclase 2 (brain) (ADCY2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, ADCY2 (Myc-DDK tagged) - Human adenylate cyclase 2 (brain) (ADCY2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ADCY2 (mGFP-tagged) - Human adenylate cyclase 2 (brain) (ADCY2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

ADCY2 (GFP-tagged) - Human adenylate cyclase 2 (brain) (ADCY2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human adenylate cyclase 2 (brain) (ADCY2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human adenylate cyclase 2 (brain) (ADCY2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADCY2 (mGFP-tagged) - Human adenylate cyclase 2 (brain) (ADCY2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human adenylate cyclase 2 (brain) (ADCY2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human adenylate cyclase 2 (brain) (ADCY2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ADCY2 (untagged)-Human adenylate cyclase 2 (brain) (ADCY2)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

ADCY2 (untagged)-Human adenylate cyclase 2 (brain) (ADCY2)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

ADCY2 (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 458-489 amino acids from the Central region of human ADCY2

ADCY2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit anti-ADCY2 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit Polyclonal Anti-ADCY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY2 antibody: synthetic peptide directed towards the middle region of human ADCY2. Synthetic peptide located within the following region: FLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLI

USD 1,870.00

4 Weeks

Transient overexpression of ADCY2 (NM_020546) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human adenylate cyclase 2 (brain) (ADCY2), Arg822-End, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli

USD 225.00

4 Weeks

Transient overexpression of ADCY2 (NM_020546) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ADCY2 (NM_020546) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack