Products

cDNA Clones (8)
Antibodies (4)
Proteins (3)
Jump to Filters
View as table Download
POLR3A (NM_007055) Human Tagged ORF Clone
RC207553

USD 600.00

In Stock

POLR3A (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3A (NM_007055) Human Tagged ORF Clone
RG207553

USD 660.00

In Stock

POLR3A (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3A (NM_007055) Human Tagged ORF Clone
RC207553L3

USD 800.00

3 Weeks

Lenti-ORF clone of POLR3A (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3A (NM_007055) Human Tagged ORF Clone Lentiviral Particle
RC207553L3V

USD 1,000.00

6 Weeks

Lenti ORF particles, POLR3A (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3A (NM_007055) Human Tagged ORF Clone
RC207553L4

USD 800.00

3 Weeks

Lenti-ORF clone of POLR3A (mGFP-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3A (NM_007055) Human Tagged ORF Clone Lentiviral Particle
RC207553L4V

USD 1,000.00

6 Weeks

Lenti ORF particles, POLR3A (mGFP-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3A (NM_007055) Human Untagged Clone
SC115726

USD 310.00

In Stock

POLR3A (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (POLR3A)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
POLR3A Rabbit Polyclonal Antibody
TA346761

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3A antibody: synthetic peptide directed towards the middle region of human POLR3A. Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT
POLR3A Rabbit Polyclonal Antibody
TA308085

USD 415.00

5 Days

Rabbit polyclonal antibody to POLR3A (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 182 and 482 of POLR3A (Uniprot ID#O14802)
POLR3A Rabbit Polyclonal Antibody
AP21068PU-N

USD 407.00

2 Weeks

POLR3A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
POLR3A (AK024744) Human Untagged Clone
SC102915

USD 660.00

In Stock

(untagged)-Human cDNA: FLJ21091 fis, clone CAS03642

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
POLR3A Rabbit Polyclonal Antibody
TA315152

USD 345.00

4 Weeks

Rabbit polyclonal anti-RPC1 / POLR3A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC1.
POLR3A (NM_007055) ICC Control Block
TB407553

USD 1,250.00

4 Weeks

Transient overexpression of POLR3A (NM_007055) in HEK293T cells paraffin embedded controls for ICC/IHC staining

POLR3A Cytosection
TS407553

USD 225.00

4 Weeks

Transient overexpression of POLR3A (NM_007055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

POLR3A Cytosection
TS407553P5

USD 889.00

4 Weeks

Transient overexpression of POLR3A (NM_007055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack