Germany
Japan
United Kingdom
China
PNPT1 (Myc-DDK-tagged)-Human polyribonucleotide nucleotidyltransferase 1 (PNPT1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PNPT1 (GFP-tagged) - Human polyribonucleotide nucleotidyltransferase 1 (PNPT1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PNPT1 (Myc-DDK-tagged)-Human polyribonucleotide nucleotidyltransferase 1 (PNPT1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PNPT1 (Myc-DDK-tagged)-Human polyribonucleotide nucleotidyltransferase 1 (PNPT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PNPT1 (mGFP-tagged)-Human polyribonucleotide nucleotidyltransferase 1 (PNPT1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PNPT1 (mGFP-tagged)-Human polyribonucleotide nucleotidyltransferase 1 (PNPT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PNPT1 (untagged)-Human polyribonucleotide nucleotidyltransferase 1 (PNPT1)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit Polyclonal Anti-PNPT1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPT1 antibody: synthetic peptide directed towards the middle region of human PNPT1. Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED |
Rabbit polyclonal anti-PNPT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PNPT1. |
PNPT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polyribonucleotide nucleotidyltransferase 1 (PNPT1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PNPT1 (46-783, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
PNPT1 (46-783, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-PNPT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PNPT1 |
Transient overexpression of PNPT1 (NM_033109) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PNPT1 (NM_033109) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PNPT1 (NM_033109) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PNPT1
Pathways
- Pyrimidine metabolism