Products

cDNA Clones (10)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
Interferon alpha (IFNA13) (NM_006900) Human Tagged ORF Clone
RG229117

USD 460.00

3 Weeks

IFNA13 (GFP-tagged) - Human interferon, alpha 13 (IFNA13)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IFNA13 (IFNA1) (NM_024013) Human Tagged ORF Clone
RC210902L4

USD 768.00

In Stock

Lenti ORF clone of Human interferon, alpha 1 (IFNA1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Interferon alpha (IFNA13) (NM_006900) Human Untagged Clone
SC327752

USD 540.00

In Stock

IFNA13 (untagged)-Human interferon alpha 13 (IFNA13)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Interferon alpha (IFNA13) Rabbit Polyclonal Antibody
TA343038

USD 375.00

5 Days

Rabbit Polyclonal Anti-IFNA13 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-IFNA13 antibody: synthetic peptide directed towards the C terminal of human IFNA13. Synthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Interferon alpha (IFNA13) (NM_006900) Human Over-expression Lysate
LC432142

USD 121.00

2 Weeks

IFNA13 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Interferon alpha (IFNA13) (NM_006900) Human Over-expression Lysate
LY432142

USD 396.00

5 Days

Transient overexpression lysate of interferon, alpha 13 (IFNA13)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Interferon alpha (IFNA13) (NM_006900) Human Untagged Clone
SC303847

USD 420.00

3 Weeks

IFNA13 (untagged)-Human interferon, alpha 13 (IFNA13)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Interferon alpha (IFNA13) ICC Control Block
TB429117

USD 1,070.00

4 Weeks

Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Interferon alpha (IFNA13) Cytosection
TS429117

USD 225.00

4 Weeks

Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Interferon alpha (IFNA13) Cytosection
TS429117P5

USD 889.00

4 Weeks

Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack