Germany
Japan
United Kingdom
China
DCP1B (Myc-DDK-tagged)-Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, DCP1B (Myc-DDK tagged) - Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DCP1B (mGFP-tagged) - Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DCP1B (GFP-tagged) - Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DCP1B (Myc-DDK tagged) - Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DCP1B (mGFP-tagged) - Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DCP1B (untagged)-Human DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of DCP1 decapping enzyme homolog B (S. cerevisiae) (DCP1B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-DCP1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP1B antibody: synthetic peptide directed towards the N terminal of human DCP1B. Synthetic peptide located within the following region: TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIR |
Carrier-free (BSA/glycerol-free) DCP1B mouse monoclonal antibody,clone OTI1G8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCP1B mouse monoclonal antibody,clone OTI2D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DCP1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DCP1B MS Standard C13 and N15-labeled recombinant protein (NP_689853)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
DCP1B mouse monoclonal antibody,clone OTI1G8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DCP1B mouse monoclonal antibody,clone OTI1G8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
DCP1B mouse monoclonal antibody,clone OTI1G8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
DCP1B mouse monoclonal antibody,clone OTI1G8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DCP1B mouse monoclonal antibody,clone OTI2D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DCP1B mouse monoclonal antibody,clone OTI2D8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
DCP1B mouse monoclonal antibody,clone OTI2D8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
DCP1B mouse monoclonal antibody,clone OTI2D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Transient overexpression of DCP1B (NM_152640) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DCP1B (NM_152640) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DCP1B (NM_152640) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DCP1B
Pathways
- RNA degradation