Germany
Japan
United Kingdom
China
PAPD7 (Myc-DDK-tagged)-Human PAP associated domain containing 7 (PAPD7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
Rabbit Polyclonal Anti-POLS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLS antibody: synthetic peptide directed towards the N terminal of human POLS. Synthetic peptide located within the following region: VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVK |
PAPD7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of PAP associated domain containing 7 (PAPD7), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of PAPD7 (NM_006999) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAPD7 (NM_001171805) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAPD7 (NM_006999) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PAPD7 (NM_006999) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PAPD7 (NM_001171805) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PAPD7 (NM_001171805) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TENT4A
Pathways
- RNA degradation