PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 900.00
3 Weeks
Lenti ORF particles, PIP5K1A (Myc-DDK tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 900.00
6 Weeks
Lenti ORF particles, PIP5K1A (mGFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 920.00
3 Weeks
Lenti ORF particles, PIP5K1A (Myc-DDK tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 920.00
3 Weeks
Lenti ORF particles, PIP5K1A (mGFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PIP5K1A (GFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 900.00
7 Weeks
Lenti ORF particles, PIP5K1A (Myc-DDK tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 900.00
7 Weeks
Lenti ORF particles, PIP5K1A (mGFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 870.00
6 Weeks
Lenti ORF particles, PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PIP5K1A (mGFP-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 870.00
6 Weeks
Lenti ORF particles, PIP5K1A (mGFP-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PIP5K1A (mGFP-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, PIP5K1A (mGFP-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 920.00
7 Weeks
Lenti ORF particles, PIP5K1A (Myc-DDK tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 920.00
7 Weeks
Lenti ORF particles, PIP5K1A (mGFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PIP5K1A (GFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PIP5K1A (GFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PIP5K1A (GFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PIP5K1A Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS |
PIP5K1A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PIP5K1A (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PIP5K1A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PIP5K1A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PIP5K1A (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
PIP5K1A (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PIP5K1A (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PIP5K1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PIP5K1A |
Transient overexpression of PIP5K1A (NM_003557) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIP5K1A (NM_001135636) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIP5K1A (NM_001135637) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIP5K1A (NM_001135638) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIP5K1A (NM_003557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PIP5K1A (NM_003557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PIP5K1A (NM_001135636) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PIP5K1A (NM_001135636) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack