Germany
Japan
United Kingdom
China
GABARAPL2 (Myc-DDK-tagged)-Human GABA(A) receptor-associated protein-like 2 (GABARAPL2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, GABARAPL2 (Myc-DDK tagged) - Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GABARAPL2 (mGFP-tagged) - Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GABARAPL2 (GFP-tagged) - Human GABA(A) receptor-associated protein-like 2 (GABARAPL2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GABARAPL2 (Myc-DDK tagged) - Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GABARAPL2 (mGFP-tagged) - Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GABARAPL2 (untagged)-Human GABA(A) receptor-associated protein-like 2 (GABARAPL2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human GABA(A) receptor-associated protein-like 2 (GABARAPL2), with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-GABARAPL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAPL2 antibody: synthetic peptide directed towards the N terminal of human GABARAPL2. Synthetic peptide located within the following region: KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV |
GABARAPL2 (1-117, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
GABARAPL2 (1-117, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression of GABARAPL2 (NM_007285) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GABARAPL2 (NM_007285) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GABARAPL2 (NM_007285) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GABARAPL2
Pathways
- Regulation of autophagy