Products

View as table Download

CREBBP (Myc-DDK-tagged)-Human CREB binding protein (CREBBP), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CREBBP (GFP-tagged) - Human CREB binding protein (CREBBP), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CREBBP (Myc-DDK-tagged)-Human CREB binding protein (CREBBP), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CREBBP (GFP-tagged) - Human CREB binding protein (CREBBP), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human CREB binding protein (CREBBP), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CREBBP (untagged)-Human CREB binding protein (CREBBP), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal anti-CREB-BP antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CREB-BP.

Rabbit Polyclonal Anti-CREB-BP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB-BP Antibody: A synthesized peptide derived from human CREB-BP

KAT3A / CBP (CREBBP) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal Anti-CBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CBP Antibody: A synthesized peptide derived from human CBP

KAT3A / CBP (CREBBP) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

CREBBP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-CREBBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CREBBP Antibody: synthetic peptide directed towards the N terminal of human CREBBP. Synthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS

Anti-CREBBP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 160-176 amino acids of Human

Transient overexpression of CREBBP (NM_001079846) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CREBBP (NM_004380) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CREBBP (NM_001079846) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CREBBP (NM_004380) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CREBBP (NM_004380) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack