Products

cDNA Clones (16)
Proteins (9)
Antibodies (7)
Jump to Filters
View as table Download
Retinoid X Receptor beta (RXRB) (NM_001270401) Human Tagged ORF Clone
RC234379

USD 560.00

5 Weeks

RXRB (Myc-DDK tagged) - Homo sapiens retinoid X receptor, beta (RXRB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Retinoid X Receptor beta (RXRB) Rabbit Polyclonal Antibody
TA345349

USD 475.00

5 Days

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG
Retinoid X Receptor beta (RXRB) (NM_021976) Human Over-expression Lysate
LC402896

USD 121.00

In Stock

RXRB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Retinoid X Receptor beta (RXRB) Rabbit Polyclonal Antibody
TA338001

USD 375.00

5 Days

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG
Retinoid X Receptor beta (RXRB) (Center) Rabbit Polyclonal Antibody
AP53774PU-N

USD 450.00

2 Weeks

Retinoid X Receptor beta (RXRB) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 262~292 amino acids from the Central region of Human RXRB
Retinoid X Receptor beta (RXRB) Goat Polyclonal Antibody
TA302594

USD 375.00

5 Days

Goat Polyclonal Antibody against RXR beta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CRDGMGDSGRDSRSP, from the internal region of the protein sequence according to NP_068811.
Retinoid X Receptor beta (RXRB) Rabbit Polyclonal Antibody
TA308585

USD 415.00

5 Days

Rabbit polyclonal antibody to Retinoid X Receptor beta (retinoid X receptor, beta)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 20 and 113 of Retinoid X Receptor beta (Uniprot ID#P28702)
Retinoid X Receptor beta (RXRB) Rabbit Polyclonal Antibody
TA330072

USD 375.00

5 Days

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: GDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPP
Retinoid X Receptor beta (RXRB) Rabbit Polyclonal Antibody
TA338002

USD 375.00

5 Days

Rabbit Polyclonal Anti-RXRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA
Retinoid X Receptor beta (RXRB) ICC Control Block
TB400516

USD 1,210.00

4 Weeks

Transient overexpression of RXRB (NM_021976) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Retinoid X Receptor beta (RXRB) ICC Control Block
TB434379

USD 1,210.00

4 Weeks

Transient overexpression of RXRB (NM_001270401) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Retinoid X Receptor beta (RXRB) ICC Control Block
TB437622

USD 1,070.00

4 Weeks

Transient overexpression of RXRB (NM_001291989) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Retinoid X Receptor beta (RXRB) Cytosection
TS400516

USD 225.00

4 Weeks

Transient overexpression of RXRB (NM_021976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Retinoid X Receptor beta (RXRB) Cytosection
TS400516P5

USD 889.00

4 Weeks

Transient overexpression of RXRB (NM_021976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Retinoid X Receptor beta (RXRB) ICC Control Sections
TS434379P5

USD 889.00

4 Weeks

Transient overexpression of RXRB (NM_001270401) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Retinoid X Receptor beta (RXRB) ICC Control Sections
TS437622P5

USD 889.00

4 Weeks

Transient overexpression of RXRB (NM_001291989) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack