LSM6 (Myc-DDK-tagged)-Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LSM6 (Myc-DDK-tagged)-Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
LSM6 (GFP-tagged) - Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LSM6 (Myc-DDK tagged) - Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LSM6 (mGFP-tagged) - Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-LSM6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the N terminal of human LSM6. Synthetic peptide located within the following region: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE |
Rabbit Polyclonal Anti-LSM6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the middle region of human LSM6. Synthetic peptide located within the following region: YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR |
Transient overexpression lysate of LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LSM6 (untagged)-Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
LSM6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LSM6 MS Standard C13 and N15-labeled recombinant protein (NP_009011)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of LSM6 (NM_007080) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LSM6 (NM_007080) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LSM6 (NM_007080) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack