Products

View as table Download

USD 98.00

USD 390.00

In Stock

LSM6 (Myc-DDK-tagged)-Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

LSM6 (GFP-tagged) - Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, LSM6 (Myc-DDK tagged) - Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, LSM6 (mGFP-tagged) - Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-LSM6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the N terminal of human LSM6. Synthetic peptide located within the following region: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE

Rabbit Polyclonal Anti-LSM6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the middle region of human LSM6. Synthetic peptide located within the following region: YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR

Transient overexpression lysate of LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

LSM6 (untagged)-Human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

LSM6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

LSM6 MS Standard C13 and N15-labeled recombinant protein (NP_009011)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of LSM6 (NM_007080) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of LSM6 (NM_007080) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of LSM6 (NM_007080) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack