Germany
Japan
United Kingdom
China
SRSF6 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, SRSF6 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SRSF6 (mGFP-tagged) - Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SRSF6 (GFP-tagged) - Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SRSF6 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SRSF6 (mGFP-tagged) - Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SRSF6 (untagged)-Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-SFRS6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS6 antibody: synthetic peptide directed towards the middle region of human SFRS6. Synthetic peptide located within the following region: KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS |
Lenti ORF clone of Human serine/arginine-rich splicing factor 6 (SRSF6), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SRSF6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of splicing factor, arginine/serine-rich 6 (SFRS6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression of SRSF6 (NM_006275) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SRSF6 (NM_006275) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SRSF6 (NM_006275) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SRSF6
Pathways
- Spliceosome