CD40LG (Myc-DDK-tagged)-Human CD40 ligand (CD40LG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CD40LG (Myc-DDK-tagged)-Human CD40 ligand (CD40LG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CD40LG (untagged)-Human CD40 ligand (CD40LG)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CD40LG (GFP-tagged) - Human CD40 ligand (CD40LG)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
In Stock
Lenti ORF particles, CD40LG (Myc-DDK tagged) - Human CD40 ligand (CD40LG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CD40LG (mGFP-tagged) - Human CD40 ligand (CD40LG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human CD40 ligand (CD40LG), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, CD40LG (Myc-DDK tagged) - Human CD40 ligand (CD40LG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CD40 ligand (CD40LG), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, CD40LG (mGFP-tagged) - Human CD40 ligand (CD40LG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700027 |
Purified recombinant protein of Human CD40 ligand (CD40LG).
Tag | Tag Free |
Expression Host | E. coli |
Purified recombinant protein of Human CD40 ligand (CD40LG / TNFSF5)
Tag | N-His |
Expression Host | HEK293 |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
Transient overexpression lysate of CD40 ligand (CD40LG)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human CD40 ligand (CD40LG), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Azide Free
Applications | FC, IHC |
Reactivities | Human |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Lenti ORF clone of Human CD40 ligand (CD40LG), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
CD40LG HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Purified
Applications | FC |
Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP |
Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CD154 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to aa 51-69 of human CD154. |
CD154 / CD40L (113-261, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
CD154 / CD40L (113-261, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
CD40LG (untagged)-Human CD40 ligand (CD40LG)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CD40LG |
USD 399.00
In Stock
CD40L biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600027 |
Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261
Tag | tag free |
Expression Host | E. coli |
Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack