Products

Proteins (18)
cDNA Clones (17)
Antibodies (7)
Jump to Filters
View as table Download
Follistatin (FST) (BC004107) Human Untagged Clone
SC123768

USD 310.00

In Stock

FST (untagged)-Human follistatin, transcript variant FST344 (cDNA clone MGC:10663 IMAGE:3688745), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Follistatin (FST) (NM_013409) Human Tagged ORF Clone
RG202523

USD 460.00

In Stock

FST (GFP-tagged) - Human follistatin (FST), transcript variant FST344

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Follistatin (FST) (NM_006350) Human Tagged ORF Clone
RG215777

USD 460.00

In Stock

FST (GFP-tagged) - Human follistatin (FST), transcript variant FST317

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Follistatin (FST) (NM_013409) Human Tagged ORF Clone
RC202523L3

USD 620.00

3 Weeks

Lenti ORF clone of Human follistatin (FST), transcript variant FST344, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Follistatin (FST) (NM_013409) Human Tagged ORF Clone
RC202523L4

USD 620.00

3 Weeks

Lenti ORF clone of Human follistatin (FST), transcript variant FST344, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Follistatin (FST) (NM_006350) Human Tagged ORF Clone
RC215777L3

USD 620.00

3 Weeks

Lenti ORF clone of Human follistatin (FST), transcript variant FST317, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Follistatin (FST) (NM_006350) Human Tagged ORF Clone
RC215777L4

USD 620.00

3 Weeks

Lenti ORF clone of Human follistatin (FST), transcript variant FST317, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Follistatin (FST) (NM_006350) Human Recombinant Protein
TP723115

USD 240.00

5 Days

Purified recombinant protein of Human follistatin (FST), transcript variant FST317.

Tag Tag Free
Expression Host E. coli
Follistatin (FST) (NM_013409) Human Over-expression Lysate
LY415607

USD 396.00

In Stock

Transient overexpression lysate of follistatin (FST), transcript variant FST344

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Follistatin (FST) (NM_013409) Human Untagged Clone
SC110159

USD 760.00

In Stock

FST (untagged)-Human follistatin (FST), transcript variant FST344

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Follistatin (FST) (NM_006350) Human Over-expression Lysate
LY416705

USD 396.00

In Stock

Transient overexpression lysate of follistatin (FST), transcript variant FST317

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Follistatin (FST) (NM_006350) Human Untagged Clone
SC309613

USD 660.00

In Stock

FST (untagged)-Human follistatin (FST), transcript variant FST317

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Follistatin (FST) Rabbit Polyclonal Antibody
TA346429

USD 475.00

5 Days

Rabbit Polyclonal Anti-FST Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FST antibody: synthetic peptide directed towards the middle region of human FST. Synthetic peptide located within the following region: ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN
Follistatin (FST) Rabbit Polyclonal Antibody
TA346430

USD 410.00

5 Days

Rabbit Polyclonal Anti-FST Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FST antibody: synthetic peptide directed towards the C terminal of human FST. Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
Follistatin (FST) (NM_013409) Human Over-expression Lysate
LC415607

USD 121.00

In Stock

FST HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Follistatin (FST) Rabbit Polyclonal Antibody
TA315058

USD 345.00

4 Weeks

Rabbit polyclonal anti-FST antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FST.
Follistatin (30-344, His-tag) Human Protein
AR50841PU-S

USD 330.00

2 Weeks

Follistatin (30-344, His-tag) human recombinant protein, 20 µg

Tag His-tag
Expression Host E. coli
Follistatin (FST) (NM_006350) Human Over-expression Lysate
LC416705

USD 121.00

In Stock

FST HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Follistatin (FST) Rabbit Polyclonal Antibody
TA319120

USD 355.00

3 Weeks

Rabbit polyclonal anti-Follistatin antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human Follistatin
Follistatin (FST) Rabbit Polyclonal Antibody
TA328316

USD 285.00

5 Days

Anti-Human Follistatin Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Follistatin
Follistatin (30-317, His-tag) Human Protein
AR51784PU-N

USD 845.00

2 Weeks

Follistatin (30-317, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Follistatin (FST) Rabbit Polyclonal Antibody
TA328315

USD 285.00

5 Days

Biotinylated Anti-Human Follistatin Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Follistatin
Follistatin (30-344, His-tag) Human Protein
AR50841PU-N

USD 845.00

2 Weeks

Follistatin (30-344, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Follistatin (30-317, His-tag) Human Protein
AR51784PU-S

USD 330.00

2 Weeks

Follistatin (30-317, His-tag) human recombinant protein, 50 µg

Tag His-tag
Follistatin (FST) (NM_013409) Human Mass Spec Standard
PH302523

USD 2,055.00

3 Weeks

FST MS Standard C13 and N15-labeled recombinant protein (NP_037541)

Tag C-Myc/DDK
Expression Host HEK293
Follistatin (FST) (NM_006350) Human Mass Spec Standard
PH315777

USD 2,055.00

3 Weeks

FST MS Standard C13 and N15-labeled recombinant protein (NP_006341)

Tag C-Myc/DDK
Expression Host HEK293
Follistatin (FST) Rabbit Polyclonal Antibody
TA350675

USD 345.00

In Stock

Rabbit Polyclonal Anti-FST Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FST
Follistatin (FST) (NM_013409) ICC Control Block
TB402523

USD 1,070.00

4 Weeks

Transient overexpression of FST (NM_013409) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Follistatin (FST) (NM_006350) ICC Control Block
TB415777

USD 1,070.00

4 Weeks

Transient overexpression of FST (NM_006350) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Follistatin (FST) Cytosection
TS402523

USD 225.00

4 Weeks

Transient overexpression of FST (NM_013409) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Follistatin (FST) Cytosection
TS402523P5

USD 889.00

4 Weeks

Transient overexpression of FST (NM_013409) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Follistatin (FST) Cytosection
TS415777

USD 225.00

4 Weeks

Transient overexpression of FST (NM_006350) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Follistatin (FST) Cytosection
TS415777P5

USD 889.00

4 Weeks

Transient overexpression of FST (NM_006350) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack