Products

cDNA Clones (7)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
TAS2R7 (NM_023919) Human Tagged ORF Clone
RC210904

USD 420.00

In Stock

TAS2R7 (Myc-DDK-tagged)-Human taste receptor, type 2, member 7 (TAS2R7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TAS2R7 (NM_023919) Human Tagged ORF Clone
RC210904L3

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 2, member 7 (TAS2R7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS2R7 (NM_023919) Human Tagged ORF Clone Lentiviral Particle
RC210904L3V

USD 820.00

6 Weeks

Lenti ORF particles, TAS2R7 (Myc-DDK tagged) - Human taste receptor, type 2, member 7 (TAS2R7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS2R7 (NM_023919) Human Tagged ORF Clone
RC210904L4

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 2, member 7 (TAS2R7), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS2R7 (NM_023919) Human Tagged ORF Clone Lentiviral Particle
RC210904L4V

USD 820.00

6 Weeks

Lenti ORF particles, TAS2R7 (mGFP-tagged) - Human taste receptor, type 2, member 7 (TAS2R7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS2R7 (NM_023919) Human Tagged ORF Clone
RG210904

USD 460.00

3 Weeks

TAS2R7 (GFP-tagged) - Human taste receptor, type 2, member 7 (TAS2R7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAS2R7 (NM_023919) Human Over-expression Lysate
LC411446

USD 121.00

In Stock

TAS2R7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAS2R7 (C-term) Rabbit Polyclonal Antibody
AP54158PU-N

USD 450.00

2 Weeks

TAS2R7 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 207-235 amino acids from the C-terminal region of human TAS2R7
TAS2R7 Rabbit Polyclonal Antibody
TA331762

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAS2R7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R7 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R7. Synthetic peptide located within the following region: DFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLL
TAS2R7 (NM_023919) Human Untagged Clone
SC305081

USD 660.00

3 Weeks

TAS2R7 (untagged)-Human taste receptor, type 2, member 7 (TAS2R7)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TAS2R7 (NM_023919) ICC Control Block
TB410904

USD 1,070.00

4 Weeks

Transient overexpression of TAS2R7 (NM_023919) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAS2R7 Cytosection
TS410904

USD 225.00

4 Weeks

Transient overexpression of TAS2R7 (NM_023919) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TAS2R7 Cytosection
TS410904P5

USD 889.00

4 Weeks

Transient overexpression of TAS2R7 (NM_023919) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack