Germany
Japan
United Kingdom
China
TPR (Myc-DDK-tagged)-Human translocated promoter region (to activated MET oncogene) (TPR). Note: ORF is codon optimized
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadTPR (GFP-tagged) - Human translocated promoter region (to activated MET oncogene) (TPR). Note: ORF is codon optimized
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-TPR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPR antibody: synthetic peptide directed towards the C terminal of human TPR. Synthetic peptide located within the following region: SSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRR |
Rabbit Polyclonal Anti-TPR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPR antibody: synthetic peptide directed towards the C terminal of human TPR. Synthetic peptide located within the following region: SQNSGEGNTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPP |
(untagged)-Human cDNA FLJ13049 fis, clone NT2RP3001428, highly similar to NUCLEOPROTEIN TPR
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TPR (untagged)-Human translocated promoter region (to activated MET oncogene) (TPR)
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of TPR (NM_003292) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TPR (NM_003292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TPR (NM_003292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TPR
Pathways
- Thyroid cancer