Products

cDNA Clones (12)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
YES1 (NM_005433) Human Tagged ORF Clone
RC208432

USD 420.00

In Stock

YES1 (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
YES1 (NM_005433) Human Tagged ORF Clone Lentiviral Particle
RC208432L1V

USD 820.00

3 Weeks

Lenti ORF particles, YES1 (Myc-DDK tagged) - Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
YES1 (NM_005433) Human Tagged ORF Clone Lentiviral Particle
RC208432L2V

USD 820.00

6 Weeks

Lenti ORF particles, YES1 (mGFP-tagged) - Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
YES1 (NM_005433) Human Untagged Clone
SC116734

USD 310.00

In Stock

YES1 (untagged)-Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
YES1 (NM_005433) Human Tagged ORF Clone
RG208432

USD 460.00

In Stock

YES1 (GFP-tagged) - Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
YES1 (NM_005433) Human Tagged ORF Clone
RC208432L3

USD 620.00

3 Weeks

Lenti ORF clone of Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
YES1 (NM_005433) Human Tagged ORF Clone Lentiviral Particle
RC208432L3V

USD 820.00

5 Weeks

Lenti ORF particles, YES1 (Myc-DDK tagged) - Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
YES1 (NM_005433) Human Tagged ORF Clone
RC208432L4

USD 620.00

In Stock

Lenti ORF clone of Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
YES1 (NM_005433) Human Tagged ORF Clone Lentiviral Particle
RC208432L4V

USD 820.00

In Stock

Lenti ORF particles, YES1 (mGFP-tagged) - Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
YES1 (NM_005433) Human Tagged ORF Clone
RC208432L1

USD 768.00

In Stock

Lenti ORF clone of Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
YES1 (NM_005433) Human Over-expression Lysate
LY401664

USD 396.00

In Stock

Transient overexpression lysate of v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
YES1 Rabbit Polyclonal Antibody
TA590206

USD 409.00

In Stock

Rabbit Polyclonal Yes1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
YES1 (284-541) Rabbit Polyclonal Antibody
AP23146PU-N

USD 440.00

2 Weeks

YES1 (284-541) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 284 and 541 of Human c-Yes
YES1 (NM_005433) Human Tagged ORF Clone
RC208432L2

USD 620.00

3 Weeks

Lenti ORF clone of Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
YES1 (NM_005433) Human Untagged Clone
SC323601

USD 760.00

In Stock

YES1 (untagged)-Kinase deficient mutant (K305M) of Human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
YES1 (NM_005433) Human Over-expression Lysate
LC401664

USD 121.00

In Stock

YES1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
YES1 (NM_005433) Human Mass Spec Standard
PH308432

USD 2,055.00

3 Weeks

YES1 MS Standard C13 and N15-labeled recombinant protein (NP_005424)

Tag C-Myc/DDK
Expression Host HEK293
YES1 Rabbit Polyclonal Antibody
TA321714

USD 345.00

4 Weeks

Anti-YES1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-193 amino acids of human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
YES1 Rabbit Polyclonal Antibody
TA358529

USD 360.00

5 Days

YES1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA
YES1 ICC Control Block
TB408432

USD 1,070.00

4 Weeks

Transient overexpression of YES1 (NM_005433) in HEK293T cells paraffin embedded controls for ICC/IHC staining

YES1 Cytosection
TS408432

USD 225.00

4 Weeks

Transient overexpression of YES1 (NM_005433) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

YES1 Cytosection
TS408432P5

USD 889.00

4 Weeks

Transient overexpression of YES1 (NM_005433) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack