HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DO beta (HLA-DOB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DO beta (HLA-DOB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human major histocompatibility complex, class II, DO beta (HLA-DOB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
HLA (GFP-tagged) - Human major histocompatibility complex, class II, DO beta (HLA-DOB)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human major histocompatibility complex, class II, DO beta (HLA-DOB), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DO beta (HLA-DOB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human major histocompatibility complex, class II, DO beta (HLA-DOB), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DO beta (HLA-DOB), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal anti-HLA-DOB antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
HLA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
(untagged)-Homo sapiens, clone MGC:31921 IMAGE:4565687, complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
HLA (untagged)-Human major histocompatibility complex, class II, DO beta (HLA-DOB)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of major histocompatibility complex, class II, DO beta (HLA-DOB)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-HLA-DOB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-DOB antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-DOB. Synthetic peptide located within the following region: LTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVR |
HLA class II DO beta / HLA-DOB (27-224, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
HLA class II DO beta / HLA-DOB (27-224, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
HLA MS Standard C13 and N15-labeled recombinant protein (NP_002111)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of HLA-DOB (NM_002120) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HLA-DOB (NM_002120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HLA-DOB (NM_002120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack