Germany
Japan
United Kingdom
China
PPP3R1 (Myc-DDK-tagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PPP3R1 (GFP-tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PPP3R1 (Myc-DDK tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PPP3R1 (mGFP-tagged) - Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP3R1 (untagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PPP3R1 (untagged)-Human protein phosphatase 3, regulatory subunit B, alpha (PPP3R1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal Anti-PPP3R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP3R1 antibody: synthetic peptide directed towards the N terminal of human PPP3R1. Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ |
PPP3R1 / Calcineurin B (1-170, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PPP3R1 / Calcineurin B (1-170, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PPP3R1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of PPP3R1 (NM_000945) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform (PPP3R1)
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of PPP3R1 (NM_000945) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP3R1 (NM_000945) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PPP3R1
Pathways
- VEGF signaling pathway